PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00172.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 977aa    MW: 111337 Da    PI: 5.0069
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00172.1_g00029.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.12.8e-5661331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeelv +yLk+k+++kk+el ++i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk gyWk
  Sme2.5_00172.1_g00029.1   6 LPPGFRFHPTDEELVAYYLKRKINAKKIEL-DIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKGGYWK 90 
                              79****************************.99***************6434555777**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  Sme2.5_00172.1_g00029.1  91 ATGKDRKVNS-QSRAVGMKKTLVYYRGRAPHGARTDWVMHEYRL 133
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-634156IPR003441NAC domain
PROSITE profilePS5100561.3316156IPR003441NAC domain
PfamPF023651.4E-297133IPR003441NAC domain
SuperFamilySSF538074.71E-9742934No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 977 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKINA KKIELDIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRKVNS QSRAVGMKKT LVYYRGRAPH  120
GARTDWVMHE YRLDERECEV ANGLQDAYAL CRVIKKSLNI NGSKIGEQQY YGSGATSDRS  180
SSIDHVYSHE RGTSCHDMME SSHGLMPSSS SSTSMALHGN SPVNNNVSAP SDEDNDDKWM  240
QYLSNEPSFA FNNTLQPIPN YGTLPFPPSK VDIALECARL QHRFTLPPLE IQDFAQVGYV  300
DQARIPAQSS FIHQASQNHL INQDSWGGNN SSCAPIDDDF SFLIPPNNNQ FHHDLDSLNF  360
MEQDDNVIRS IDVGDFDHED FKSDRMVENL RWIGMSNRDL EKTFLEDYKT VPLENVSTVQ  420
REEHELQGEN SGQTNSFNET EANNFSIGFD NLLDNDDVFS NSPSFEVYEK VEVNHGFFIA  480
TRQASKTFYH QLTPSRTLKI HRNLVPVLHD FPKNTTSLEN FVTSPWTTTM RTLGGIVAIL  540
QTFWIYFGEY LEWEAKGFKL EDKKGVYEEY CLMERVEKKI KKVQDFKWDF YKQNKFPIGD  600
RKEGKWPNYL TLVVALSSSL EYANAATPTV KVGNISKVTD SAYFRIYYGQ TFKVIKNTLD  660
GKSYLLIQLL GLLGNLKGIT STYVASQCVL KLYQDGQIEN VNKNDPQQLA QYAAHFIANT  720
DEAQPCNFAT FVPVGEDAPL QVTIPTYYEQ LSFTLSRAEW IKYLGVFANM ENRANQVYDA  780
IKENYLCLSK AATSRISFKP TVSWMEYKDG VWSFTREPYK LKFVEDAGGA NIDDSINKVT  840
YNMSIPDDLE ELHAILCTVD VVIDETYTSD PEVYNGSTFL GNINLADQTC FAFLTNQSIW  900
RYDKRVQNYT VLDWYDGAVS QPQLLLADII EALYPSGNYN TTYFRNIAKG EGIISIVPEM  960
CERDSSIPME PTVVPCQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-54213311140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-168HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348211.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLK4B9Z70.0K4B9Z7_SOLLC; Uncharacterized protein
STRINGSolyc02g081270.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-144NAC domain containing protein 28